Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_005229132 putative RNA-binding protein with unique protein fold [Klebsiella pneumoniae subsp. pneumoniae HS11286].

Genbank/GenpeptView on NCBI
>YP_005229132 putative RNA-binding protein with unique protein fold [Klebsiella pneumoniae subsp. pneumoniae HS11286].
mnnnlpseavahavavlknehviaypteavfgvgcdpdsetavmrllelkqrpvekgliliaasfeqlkpyiddsrlsdsqreaifscwpgpvtfvfpar
petprwltgrfdslavrvtnhplvielceaygkplvstsanltgqppcrttaevhaqfgdsfpvvdgatggrqnpseirdaltgelfrqg