Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

YP_005227380 amino acid ABC transport system periplasmic binding component [Klebsiella pneumoniae subsp. pneumoniae HS11286].


>YP_005227380 amino acid ABC transport system periplasmic binding component [Klebsiella pneumoniae subsp. pneumoniae HS11286].
mvknllkvccmiaaltaagqaaaetytvgsggtyrpfefensqkqlegfdidiikaiakaegfdvklvntpwegifatlntgdrdiiisgititdkrkqm
vdfsapyfpaeqsivvaqdsqvdslaalknekvgvvnsstgdivvsevlgknstaikrfdntplmlqelfedgvsaavgdvgvvkyyikqhpekqfklvp
dakferqyfgiavakgnsellgkinaglqkivadgtyakiyktwfddnvptlpaq