Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
>YP_005226641 regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system [Klebsiella pneumoniae subsp. pneumoniae HS11286]. myniddydlkiltllqangrltnqelseliglsasqcsrrrialeqaqlilgyharlapdaagqemlglievrllnhtpqcvesfhqmlsevdaildawk ttgdadyllrvtvpdlpglshlishilaqnkgvahlktavvlnrlkengqlmpgttplr