Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

XP_059224364 elongation of very long chain fatty acids protein 4-like [Stomoxys calcitrans].


>XP_059224364 elongation of very long chain fatty acids protein 4-like [Stomoxys calcitrans].
mallnfhilkevvvnasqlnynylcqpcrviyskheiklaaavwwfyfskllefsdtlffilrhkwkqltplhiyhhstmfplwwiaikwlptgstfipv
linsfvhvimytyyglsacgpavqkylwwkkyltaiqlvqfttgllwalqailakcdfplaincatmvymisflilfgkffrreyqrpdkvrkis