Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

XP_059222661 V-type proton ATPase 16 kDa proteolipid subunit c [Stomoxys calcitrans].


>XP_059222661 V-type proton ATPase 16 kDa proteolipid subunit c [Stomoxys calcitrans].
madsgsdnpiygpffgvmgaasaiifsalgaaygtaksgtgiaamsvmrpelimksiipvvmagiiaiyglvvavliagaleepskytlykgfihlgagl
avgfsglaagfaigivgdagvrgtaqqprlfvgmililifaevlglyglivaiylytk