Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

XP_013117322 mediator of RNA polymerase II transcription subunit 10 [Stomoxys calcitrans].


>XP_013117322 mediator of RNA polymerase II transcription subunit 10 [Stomoxys calcitrans].
msaplenletqlemfienvrqiriivsdfqpqgqnvlnqkiqglvsglqeinklknqvqdiyvpfevfdyidqdknpqlytkdcvekalakneevkgkid
ayrkfksnmlaelfktfpnemnmyrayrpdsv