Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_014342975 OB-fold nucleic acid binding domain-containing protein [Klebsiella pneumoniae].

Genbank/GenpeptView on NCBI
>WP_014342975 OB-fold nucleic acid binding domain-containing protein [Klebsiella pneumoniae].
mrtrrdskagfsflavydgscfdpvqavinnslpnynqevlrlttgcsvivtgkvvasqgqgqsfeiqatsvevtgwvedpdtypmaakrhsieylreva
hlrprtnligavarvrhtlaqalhrffneqgffwvstr