Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_010895582 MULTISPECIES: SctI family type III secretion system inner rod subunit PscI [Pseudomonas].


>WP_010895582 MULTISPECIES: SctI family type III secretion system inner rod subunit PscI [Pseudomonas].
mdisrmgaqaqitsleelsggpagaahvaeferamggagslggdllselgqirerfsqakqelqmelstpgddpnslmqmqwslmritmqeeliaktvgr
msqnvetlmktq