Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_003091369 MULTISPECIES: GspM family type II secretion system protein XcpZ [Pseudomonas].


>WP_003091369 MULTISPECIES: GspM family type II secretion system protein XcpZ [Pseudomonas].
mkvmtqfherlraqaetsqlairwrglpardrlallwlgaflllvvlylalwrpaerhlqsarqyfteqralhayiqqqapnvrqadaaapqaqidpaal
qgmvtasaaqaglsverldnegegavqvalqpapfakllpwleqlngqgvqvaeagldrqvdgrvsarlslrve