Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_003087693 MULTISPECIES: Acr1 family type III secretion system gatekeeper subunit Pcr1 [Pseudomonas].


>WP_003087693 MULTISPECIES: Acr1 family type III secretion system gatekeeper subunit Pcr1 [Pseudomonas].
maygpseltgaviallekrwvgvaevqalleplpladvarqihffrelkrlyrllpvevfgddeqrqnllnacqmaldlaiereeeqqhglg