Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_003087185 MULTISPECIES: low molecular weight protein tyrosine phosphatase family protein [Pseudomonas].


>WP_003087185 MULTISPECIES: low molecular weight protein tyrosine phosphatase family protein [Pseudomonas].
mhrvlficsrnrlrspsaerlfadwpgvetdsaglaadaetplereqlewatlvvvmerrhrqallrrhaaamkgkrlvcldipddyaymqaellhller
kagpflrrd