Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_003083121 MULTISPECIES: EscU/YscU/HrcU family type III secretion system export apparatus switch protein [Pseudomonas].


>WP_003083121 MULTISPECIES: EscU/YscU/HrcU family type III secretion system export apparatus switch protein [Pseudomonas].
mnrkqspaprqaialsydgqaaptlsakgdaelaeailaiardyevpiyenaelvrllarlelgdaipealyrtiaeiiafawhlkgkcpegfapdaadg
nqmlllggpgd