Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_001574409 MULTISPECIES: SctI family type III secretion system inner rod subunit SsaI [Enterobacteriaceae].


>WP_001574409 MULTISPECIES: SctI family type III secretion system inner rod subunit SsaI [Enterobacteriaceae].
msvvpvstqsyvkssaepsqeqinffeqllkdeastsnasallpqvmltrqmdymqltvgvdylarisgaasqalnkldnma