Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_001417601 MULTISPECIES: outer membrane protein assembly factor BamE domain-containing protein [Enterobacterales].


>WP_001417601 MULTISPECIES: outer membrane protein assembly factor BamE domain-containing protein [Enterobacterales].
mknetqesvktkivkgkttkqdvlasfgepdsrslidgeeqwsytmynsqskatsfipvvgllaggadsqtksltvsfkgekvstyifnagtsnvktgif