Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_001223304 MULTISPECIES: SPI-2 type III secretion system apparatus protein SsaP [Salmonella].


>WP_001223304 MULTISPECIES: SPI-2 type III secretion system apparatus protein SsaP [Salmonella].
mritkvegslglpcqsyqddneaeaermdfeqlmhqalpigennppaalnknvvftqryrvsggyldgvecevcesggliqlrinvphheiyrsmkalkq
wlesqllhmgyiisleifyvknse