Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_001063681 type III secretion system LEE switch protein SepD [Escherichia coli].


>WP_001063681 type III secretion system LEE switch protein SepD [Escherichia coli].
mnnnngiakndcdwltaldfvkdvngspthltfyiyqknaflhdfgnywvlyielsgdfrqvptdtfirlcnilavsneykqmgiflsnkkwylcqifhk
dnnhranmskaimqhtlaslldkqfdkleqlsssdtmmppthlfsdigriv