Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_000457355 EscG/YscG/SsaH family type III secretion system needle protein co-chaperone [Salmonella enterica].


>WP_000457355 EscG/YscG/SsaH family type III secretion system needle protein co-chaperone [Salmonella enterica].
mfagvnhslisqvhamlpaltvivpdkklqlvclalllaglneplkaakilsdidlpeamalrllfpapnegfen