Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_000342503 MULTISPECIES: SPI-1 type III secretion system export apparatus protein SpaQ [Salmonella].


>WP_000342503 MULTISPECIES: SPI-1 type III secretion system export apparatus protein SpaQ [Salmonella].
mddlvfagnkalylvlilsgwptivatiigllvglfqtvtqlqeqtlpfgikllgvclclfllsgwygevllsygrqviflalakg