Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_000245816 type III secretion system LEE needle protein cochaperone EscG [Escherichia coli].


>WP_000245816 type III secretion system LEE needle protein cochaperone EscG [Escherichia coli].
mvndisankilvwaavaaanhklpkyaeailnvfpqiipdkkdiahlefiilfglnrkndavkaledcmddetsqllyslvhengsgwvrgf