Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

WP_000042916 MULTISPECIES: IS66 family insertion sequence element accessory protein TnpA [Enterobacteriaceae].


>WP_000042916 MULTISPECIES: IS66 family insertion sequence element accessory protein TnpA [Enterobacteriaceae].
mskprwtldqkkhhvaawrasgltreqycelydipfkslrqwpqdvakaekrarapeiipvsvsgssgmtdgrplsdepvtlflpggirmccqpsqltdv
fralrhada