Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_709126 glutathione-regulated potassium-efflux system ancillary protein KefG [Shigella flexneri 2a str. 301].


>NP_709126 glutathione-regulated potassium-efflux system ancillary protein KefG [Shigella flexneri 2a str. 301].
msqpakvlllyahpesqdsvanrvllkpatqlsnvtvhdlyahypdffidipreqallrehevivfqhplytyscpallkewldrvlsrgfasgpggnql
agkywrnvittgepesayrydalnrypmsdvlrpfelaagmcrmhwlspiiiywarrqsakelasharaygdwlanplspggr