Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_708329 formate hydrogenlyase maturation protein HycH [Shigella flexneri 2a str. 301].


>NP_708329 formate hydrogenlyase maturation protein HycH [Shigella flexneri 2a str. 301].
mptihvsivsfsnsfaysggymteecgeivfwtlrkkfvassdempehssqvmyyslaighhvgvidclnvafrcplteyedwlalveeeqarrkmlgvm
tfgeividashtalltrafapladdatsvwqarsiqfihlldeivlepaiylmarkia