Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_707216 peripheral inner membrane phage-shock protein [Shigella flexneri 2a str. 301].


>NP_707216 peripheral inner membrane phage-shock protein [Shigella flexneri 2a str. 301].
mntrwqqagqkvklgfklagklvlltalrygpagvagwaiksvarrplkmllavalepllsraanklaqrykr