Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_706766 stationary phase/starvation inducible regulatory protein CspD [Shigella flexneri 2a str. 301].


>NP_706766 stationary phase/starvation inducible regulatory protein CspD [Shigella flexneri 2a str. 301].
mekgtvkwfnnakgfgficpegggedifahystiqmdgyrtlkagqsvqfdvhqgpkgnhasvivpveveaava