Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_706242 insertion element IS1 protein InsA [Shigella flexneri 2a str. 301].


>NP_706242 insertion element IS1 protein InsA [Shigella flexneri 2a str. 301].
masisircpscsategvvrngkstaghqrylcshcrktwqlqftytvsqpgthqkiidmamngvgcrasarimgvglntvlrhlknsgrsr