Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_569946 late endosomal/lysosomal adaptor, MAPK and MTOR activator 5, isoform A [Drosophila melanogaster].


>NP_569946 late endosomal/lysosomal adaptor, MAPK and MTOR activator 5, isoform A [Drosophila melanogaster].
meqqlekvlaeiaarqdtvgallanrqglclgtkgdidpnvsgigmaiseqvaklelnatapaticlysgnkrcviqkdgeitgvifkqptgtsatapsn