Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_462923 hypothetical protein STM4042A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].


>NP_462923 hypothetical protein STM4042A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].
mnvgcfmtqpisviarslvrerqrtglslaeiarragiakstlsqleagngnpsletlwslcvaldipfarllepqvqktqvirrgegtkvvaeqahyqa
illaacppgarrdiyllltqpgadrishphppgsvehiivtqgkalvglteapeelaegdyicypgdqahifkalepdtqailvaeqn