Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_462479 small ubiquitous protein required for normal growth [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].


>NP_462479 small ubiquitous protein required for normal growth [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].
msdlfsspdhtldalglrcpepvmmvrktvrnmqtgetlliiaddpattrdipgfctfmehdllaqeteglpyryllrkah