Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_462090 putative bacterial regulatory helix-turn-helix protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].


>NP_462090 putative bacterial regulatory helix-turn-helix protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].
mndlisaayserlrrvcdhierhldeplsiealsrmahsspfhfhrqfttwsglplyryiqwlrlrraswrlafnpqdkvidialdagfqnpesftrafk
tafgqsprrfrqspdwlawhqrvpklalqeqhvmdvkivefpptrvamlthlghpdkvnasaakfiawrretgqspiassqtfgiawhdpqttppaqfrf
dicgsvrqpiaendvgvvnseipggrcavvrhqgsldslpesvwylfrewlpasgetprdfpvffqylnfvhevaehelltdiylplr