Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_461199 periplasmic small subunit nitrate reductase of cytochrome C550 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].


>NP_461199 periplasmic small subunit nitrate reductase of cytochrome C550 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].
mkshdlmkalcqwmatlalvvsgavwaangvdlsqspevsgtqegairmpkeqermplnyvnqppmiphsvegyqvttntnrclqchgvesyrttgapri
spthfmdsdgkvsgnvaprryfclqchvpqsdtapiidntftpsqgygk