Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_460138 acetylation of N-terminal alanine of 30S ribosomal subunit protein S5 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].

Genbank/GenpeptView on NCBI
>NP_460138 acetylation of N-terminal alanine of 30S ribosomal subunit protein S5 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].
mfgyrsnvpkvrlttdrlvvrlvherdawrladyyaenrhflkpwepvrdeshcypsgwqarlgmigefhkqgsafyfalldpeekeiigvanfsnvvrg
sfhacylgysiaqkwqgqglmfealtaairymqrtqhihrimanymphnkrsgallarlgfekegyakdyllidgqwrdhvltalttplwtpgr