Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_459115 3-isopropylmalate isomerase (dehydratase), subunit with LeuC [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].


>NP_459115 3-isopropylmalate isomerase (dehydratase), subunit with LeuC [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2].
maekftqhtglvvpldaanvdtdaiipkqflqkvtrtgfgahlfndwrfldekgqqpnpefvlnfpeyqgasillarenfgcgssrehapwaltdygfkv
viapsfadifygnsfnnqllpvtlsdaqvdelfalvkanpgikfevdleaqvvkagdktysfkiddfrrhcmlngldsigltlqhedaiaayenkqpafm
r