Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_418623 30S ribosomal subunit protein S18 [Escherichia coli str. K-12 substr. MG1655].


>NP_418623 30S ribosomal subunit protein S18 [Escherichia coli str. K-12 substr. MG1655].
maryfrrrkfcrftaegvqeidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrhq