Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_418582 DUF2645 domain-containing inner membrane protein YjeO [Escherichia coli str. K-12 substr. MG1655].


>NP_418582 DUF2645 domain-containing inner membrane protein YjeO [Escherichia coli str. K-12 substr. MG1655].
msarmfvlcciwfivaflwititsaldkewmidgrginnvcdvlmyleeddtrdvgvimtlplffpflwfalwrkkrgwfmyatalaifgywlwqfflry
qfcl