Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_418571 protein chain elongation factor EF-P [Escherichia coli str. K-12 substr. MG1655].

Genbank/GenpeptView on NCBI
>NP_418571 protein chain elongation factor EF-P [Escherichia coli str. K-12 substr. MG1655].
matyysndfraglkimldgepyaveasefvkpgkgqafarvklrrlltgtrvektfkstdsaegadvvdmnltylyndgefwhfmnnetfeqlsadakai
gdnakwlldqaecivtlwngqpisvtppnfveleivdtdpglkgdtagtggkpatlstgavvkvplfvqigevikvdtrsgeyvsrvk