Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_418119 DUF1198 domain-containing protein YicN [Escherichia coli str. K-12 substr. MG1655].


>NP_418119 DUF1198 domain-containing protein YicN [Escherichia coli str. K-12 substr. MG1655].
miwimlatlavvfvvgfrvltsgarkairrlsdrlnidvvpvesmvdqmgksagdeflrylhrpdeshlqnaaqvlliwqivivdgseqnllqwhrilqk
arlaapitdaqvrlalgflretepemqdinafqmrynaffqpaegvhwlh