Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_418044 DUF3302 domain-containing protein YiaW [Escherichia coli str. K-12 substr. MG1655].


>NP_418044 DUF3302 domain-containing protein YiaW [Escherichia coli str. K-12 substr. MG1655].
mfldyfalgvlifvflvifygiiilhdipyliakkrnhphadaihvagwvslftlhviwpflwiwatlyrpergwgmqshdssvmqlqqriaglekqlad
iksssae