Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_417901 IS1 family protein InsA [Escherichia coli str. K-12 substr. MG1655].


>NP_417901 IS1 family protein InsA [Escherichia coli str. K-12 substr. MG1655].
masvsiscpscsatdgvvrngkstaghqrylcshcrktwqlqftytasqpgthqkiidmamngvgcratarimgvglntilrhlknsgrsr