Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_417780 30S ribosomal subunit protein S10 [Escherichia coli str. K-12 substr. MG1655].


>NP_417780 30S ribosomal subunit protein S10 [Escherichia coli str. K-12 substr. MG1655].
mqnqririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardqyeirthlrlvdiveptektvdalmrldlaagvdvqi
slg