Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_417752 DUF1992 domain-containing protein YhdN [Escherichia coli str. K-12 substr. MG1655].


>NP_417752 DUF1992 domain-containing protein YhdN [Escherichia coli str. K-12 substr. MG1655].
mwlldqwaerhiaeaqakgefdnlagsgeplildddshvppelragyrllknagclppeleqrreaiqlldilkgirhddpqyqevsrrlsllelklrqa
glstdflrgdyadklldkindn