Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_417569 ribosome- and membrane-associated DUF883 domain-containing protein YqjD [Escherichia coli str. K-12 substr. MG1655].


>NP_417569 ribosome- and membrane-associated DUF883 domain-containing protein YqjD [Escherichia coli str. K-12 substr. MG1655].
mskehttehlraelkslsdtleevlsssgekskeelskirskaeqalkqsryrlgetgdaiakqtrvaaaradeyvrenpwtgvgigaaigvvlgvllsr
r