Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_417229 DUF3561 domain-containing inner membrane protein YgbE [Escherichia coli str. K-12 substr. MG1655].

Genbank/GenpeptView on NCBI
>NP_417229 DUF3561 domain-containing inner membrane protein YgbE [Escherichia coli str. K-12 substr. MG1655].
mrnshnitltnndsltedeettwslpgavvgfiswlfalampmliygsntlfffiytwpfflalmpvavvvgialhslmdgklrysivftlvtvgimfga
lfmwllg