Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_416891 DUF2502 domain-containing protein YpeC [Escherichia coli str. K-12 substr. MG1655].


>NP_416891 DUF2502 domain-containing protein YpeC [Escherichia coli str. K-12 substr. MG1655].
mfrslflaaalmaftplaanageitllpsiklqigdrdhygnywdgghwrdrdywhrnyewrknrwwrhdngyhrgwdkrkayergyregwrdrddhrgk
grghghrh