Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_416650 DUF2542 domain-containing protein YeiS [Escherichia coli str. K-12 substr. MG1655].


>NP_416650 DUF2542 domain-containing protein YeiS [Escherichia coli str. K-12 substr. MG1655].
mdvqqffvvavfflipifcfreawkgwragaidkrvknapepvyvwraknpglffaymvayigfgilsigmivylifyr