Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_416351 DUF1482 domain-containing protein YebW [Escherichia coli str. K-12 substr. MG1655].


>NP_416351 DUF1482 domain-containing protein YebW [Escherichia coli str. K-12 substr. MG1655].
mfalvlfvcyldggcedivvdvynteqqclysmsdqrirqggcfpiedfidgfwrpaqeygdf