Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_416145 SoxR [2Fe-2S] reducing system protein RsxB [Escherichia coli str. K-12 substr. MG1655].


>NP_416145 SoxR [2Fe-2S] reducing system protein RsxB [Escherichia coli str. K-12 substr. MG1655].
mnaiwiavaavsllglafgailgyasrrfaveddpvvekideilpqsqcgqcgypgcrpyaeaiscngekinrcapggeavmlkiaellnvepqpldgea
qeitparmvavidenncigctkciqacpvdaivgatramhtvmsdlctgcnlcvdpcpthcislqpvaetpdswkwdlntipvriipvehha