Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_416064 putative tail fiber assembly protein TfaQ [Escherichia coli str. K-12 substr. MG1655].

Genbank/GenpeptView on NCBI
>NP_416064 putative tail fiber assembly protein TfaQ [Escherichia coli str. K-12 substr. MG1655].
mafrmseqprtikiynllagtnefigegdayipphtglpanstdiappdipagfvavfnsdesswhlvedhrgktvydvasgdalfiselgplpenvtwl
spegefqkwngtawvkdteaeklfrireaeetknnlmqvasehiaplqdaadleiateeeislleawkkyrvllnrvdtstaqdiewpalp