Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_415690 PF13436 family protein YmgG [Escherichia coli str. K-12 substr. MG1655].


>NP_415690 PF13436 family protein YmgG [Escherichia coli str. K-12 substr. MG1655].
mkkkilafglisalfcstpamadmnrttkgallgagvglltgngvngvlkgaavgagvgavtekgrdgknarkgakvgaavgavtgvltgnglegaikga
viggtggailgkmk