Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_415630 DUF1471 domain-containing multiple stress resistance outer membrane protein BhsA [Escherichia coli str. K-12 substr. MG1655].


>NP_415630 DUF1471 domain-containing multiple stress resistance outer membrane protein BhsA [Escherichia coli str. K-12 substr. MG1655].
mknvktliaaailssmsfasfaavevqstpegqqkvgtisanagtnlgsleeqlaqkademgaksfritsvtgpntlhgtaviyk