Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_415525 stress-induced bacterial acidophilic repeat motifs-containing protein YmdF [Escherichia coli str. K-12 substr. MG1655].


>NP_415525 stress-induced bacterial acidophilic repeat motifs-containing protein YmdF [Escherichia coli str. K-12 substr. MG1655].
manhrggsgnfaedreraseagkkggqhsggnfkndpqraseagkkggksshgksdn